PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.TF48T
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 696aa    MW: 75113.7 Da    PI: 6.1299
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.TF48TgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.3e-32272329260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  Aradu.TF48T 272 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSH-EGHITEIIYKGAHNHPK 329
                  7****************************************.***************85 PP

2WRKY102.91.8e-32488546159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+++d k v++tYeg+Hnh+
  Aradu.TF48T 488 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCTVRKHVERASHDLKSVITTYEGKHNHD 546
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.2E-29270330IPR003657WRKY domain
SuperFamilySSF1182906.67E-26270330IPR003657WRKY domain
SMARTSM007741.1E-36271329IPR003657WRKY domain
PfamPF031062.8E-25272328IPR003657WRKY domain
PROSITE profilePS5081123.399272330IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-37473548IPR003657WRKY domain
SuperFamilySSF1182901.83E-28480548IPR003657WRKY domain
PROSITE profilePS5081138.32483548IPR003657WRKY domain
SMARTSM007741.9E-37488547IPR003657WRKY domain
PfamPF031067.1E-25489546IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MAGIDENVGV PGDWSGPSPS PRTFFSVMLG EDNVARSMSD PPPGGDGAQD GDQKLVSRGG  60
LVERMAARAG FNAPRLNTDT IRSTDLSLNS DVPSPYLTIP PGLSPTTLLD SPVFLTNSLA  120
QPSPTTGKFP FISNGNISSD APERCKDNSF DDIYASSFAF KPTTDLGSSF YQGAARKMNP  180
TTIAQQSLPG VEVHVQSEHS FQSRSADVVK SQTQNKNGLH LQPDFIESSP QQDTVGVSLE  240
HSPQLEEQGD EEGEPRGNGD SMAAGFGGAP SEDGYNWRKY GQKQVKGSEY PRSYYKCTHP  300
NCPVKKKVER SHEGHITEII YKGAHNHPKP PPNRRSGIAS ANPPSDMQMD NPEHVERQSG  360
SDGELGWANL QKGNVAGAAN WKNDNLEVTS SASVAPEYCN QSTNSQAQNG TQFDSGDAVD  420
ASSTFSNEDD DDDRGTHGSV SLGYDGEGDE SESKRRKLES YATELSGATR AIREPRVVVQ  480
TTSEVDILDD GYRWRKYGQK VVKGNPNPRS YYKCTNAGCT VRKHVERASH DLKSVITTYE  540
GKHNHDVPAA RSSSHVNANA SGSVPGQAPG VLQPHVHRPE PTQVPGGIGR LERPPALGAF  600
NLPGRQQLGP PHGFSFGMNQ PLLPNLAMPG FGPGQSKLPV MPVHPFLATQ QQRPPNEMGF  660
MLPKGEPNVE PIPERHNLPS GSYQDLMSRM PLGPHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A4e-36272549878Probable WRKY transcription factor 4
1wj2_A4e-36272549878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015967863.10.0PREDICTED: probable WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLV7BVU40.0V7BVU4_PHAVU; Uncharacterized protein
STRINGGLYMA06G47880.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95243443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2