PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.T9MSY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 171aa    MW: 19963.8 Da    PI: 5.7888
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.T9MSYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.12.5e-30107165159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYG+K+vk+s++pr+YYrC+  gC+vkk+ver+++dp +v++tYeg H h+
  Aradu.T9MSY 107 LDDGYKWRKYGKKMVKNSPNPRNYYRCSVDGCSVKKRVERDRDDPMYVITTYEGIHIHH 165
                  59******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-3194165IPR003657WRKY domain
SuperFamilySSF1182902.09E-27100166IPR003657WRKY domain
PROSITE profilePS5081129.057102167IPR003657WRKY domain
SMARTSM007749.2E-35107166IPR003657WRKY domain
PfamPF031062.1E-23108165IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MTDQKDHQIP EAESPPESDD LSNNWSLELS DYLAIDDDTQ WLDDESFVSQ HNLYHQNYVF  60
HHQPPIQVEG ATSNFEGSSS TNISSGQEKK EARHRYAFKT KSEVEVLDDG YKWRKYGKKM  120
VKNSPNPRNY YRCSVDGCSV KKRVERDRDD PMYVITTYEG IHIHHPSSSR Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-2597164774Probable WRKY transcription factor 4
2lex_A8e-2597164774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015972155.11e-127PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ54e-41WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A0B2RBG76e-60A0A0B2RBG7_GLYSO; Putative WRKY transcription factor 50
TrEMBLI1JTZ85e-60I1JTZ8_SOYBN; Uncharacterized protein
STRINGGLYMA04G05700.11e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.13e-42WRKY DNA-binding protein 50