PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.T5PPZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 300aa    MW: 33868.8 Da    PI: 6.0729
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.T5PPZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.21.2e-37101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC+++C lapyfpa+qpk f nvhklFG+sn++k+lk+++++++++am+s++ +A  r + Pv+G+v+ i +lq+q+  +++el+++ 
  Aradu.T5PPZ  10 ACAACKFQRRKCTPECLLAPYFPADQPKVFLNVHKLFGVSNIVKILKDVDPSQKKNAMESIIVQASYRDKYPVRGCVEEICRLQNQIWLHEEELHAVY 107
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                  ++
  Aradu.T5PPZ 108 QQ 109
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5859110IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-3710106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MTLKGGTTQA CAACKFQRRK CTPECLLAPY FPADQPKVFL NVHKLFGVSN IVKILKDVDP  60
SQKKNAMESI IVQASYRDKY PVRGCVEEIC RLQNQIWLHE EELHAVYQQL EMCRQHQQQQ  120
HQGIHHVVPD DLASQLELGM APRAANNALP LFNHAPQPQQ QQQQVYNTSV AALPVSQQHS  180
YSNSNSVDYN SLYIESKENN NNGTNPLWVP YANNNGSPIA MQSQMVTSQA LSMHQEAAGD  240
YDEMHPFFET IDDRQSYIYS KEAYESSSEE SLKDSRKCTE HVAENELKSA AACFSLTSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-2961107111LOB family transfactor Ramosa2.1
5ly0_B7e-2961107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.T5PPZ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015970333.10.0LOB domain-containing protein 27
TrEMBLA0A445EJ370.0A0A445EJ37_ARAHY; Uncharacterized protein
STRINGXP_007155357.11e-139(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-42LOB domain-containing protein 27