PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.SD5C0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family SBP
Protein Properties Length: 514aa    MW: 56488 Da    PI: 7.205
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.SD5C0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP80.42.5e-25126185261
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrs 61 
                  Cqv gC++dls+ k+yh+rhkvCevhsk++vv+v+g+eqrfCqqCsr  ++s f+ +k s
  Aradu.SD5C0 126 CQVYGCNKDLSSSKDYHKRHKVCEVHSKTAVVIVNGIEQRFCQQCSRLVNFSSFNLSKYS 185
                  ******************************************************998876 PP

2SBP45.91.5e-141922204977
                  EEETTT--SS--S-STTTT-------S-- CS
          SBP  49 fhelsefDeekrsCrrrLakhnerrrkkq 77 
                  fh l efD++krsCr+rLa+hnerrrk+q
  Aradu.SD5C0 192 FHLLAEFDDGKRSCRKRLAGHNERRRKPQ 220
                  9**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.8E-28120206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.444123219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-24125185IPR004333Transcription factor, SBP-box
PfamPF031106.4E-20126183IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-11192222IPR004333Transcription factor, SBP-box
PfamPF031101.1E-7192218IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MESSWDYVTE EDKGYVSNDA LSAAPPPPPS TLLRSKSSFL GWELKTPCSS FDNQCFEELG  60
FPELLGKPFS GRDSLIDLKL GRFADHADVN VASFSKGAPV LCSSVSSTAP KRPRGSLGLH  120
SQTSYCQVYG CNKDLSSSKD YHKRHKVCEV HSKTAVVIVN GIEQRFCQQC SRLVNFSSFN  180
LSKYSSLILD LFHLLAEFDD GKRSCRKRLA GHNERRRKPQ AGIHSGKAAR LLHPCGSGNI  240
LVVLVDSRFQ GTMLSSASFI SSDSDKYGMS SFWKHGSDFW HPESRSLFPS YNGKQFPFLH  300
ESGATPTTTE SIFYENNNQY KHVIAAQHPG SRPLFQNSSL GSDDFNLFDT SSTVQGLSGI  360
SDSCCALSLL SSQSQNSSGQ SSGIPFVPPM VSPSSHSHPC SISQVSEKIG MSSQTSSCRV  420
YDRFPSALNP ASGSQLSPIL ISDNNNIVNF EMADRIFQGS DFANARDRLS CEDVATIDLL  480
QLSSQLQRVE HQRQSLQEFN STDNSAVNLI LIWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-25115218484squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.SD5C0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015943723.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A445AZ730.0A0A445AZ73_ARAHY; Uncharacterized protein
STRINGGLYMA0005S50.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-43SBP family protein