PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.S9TS8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 334aa    MW: 37069 Da    PI: 4.9294
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.S9TS8genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.62.2e-32151207258
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  dDgy+WrKYGqK++k+s++prsYYrCt ++C++kk+vers+edp++++itYeg H h
  Aradu.S9TS8 151 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCSAKKQVERSNEDPDTLIITYEGLHLH 207
                  8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.278145210IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-29148207IPR003657WRKY domain
SuperFamilySSF1182901.15E-26148207IPR003657WRKY domain
SMARTSM007742.1E-35150209IPR003657WRKY domain
PfamPF031065.1E-26151207IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MVESTTNALM TMMMEEEVIL MSSNSNSNSN SSCSEGSEDD DLVKELLDDA TPLLLPPSDH  60
YNTIIRPPPS DGDGDDYDHA INSFISNIYS GPTISNFENA LSVINNSNNH QSDQHLEHLS  120
SARVSILERG LSKIENKYTL KFKCFGNGMG DDGYKWRKYG QKSIKNSPNP RSYYRCTNPR  180
CSAKKQVERS NEDPDTLIIT YEGLHLHFAY PHFLTGQPHQ SQSDPPIKKP KPMPTASPEN  240
KAQEILEAKD VQANPTLGLI QTTLTDSQED MANVNLGSQG LLEDMVPFMV RNPHNNGNST  300
NSLFSCSSQP TTPPSLWFPN YSTSCHTVGL NFSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-201512071571WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150372e-47AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015960810.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLK7L1H51e-140K7L1H5_SOYBN; Uncharacterized protein
STRINGGLYMA07G16040.21e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.14e-46WRKY DNA-binding protein 49