PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.S821T
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 206aa    MW: 23644.1 Da    PI: 9.9311
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.S821TgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.41.1e-191662147
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                 kr+e + +r+vtfskR+ g++ K  ELS+LC+ae a+ii s++gkly
  Aradu.S821T 16 KRVEQSNKRHVTFSKRKLGLFNKVTELSILCQAETALIISSQNGKLY 62
                 7899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-24867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.128868IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-21977IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-181030IPR002100Transcription factor, MADS-box
PfamPF003193.6E-181762IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MVSSQATTRR RKIEIKRVEQ SNKRHVTFSK RKLGLFNKVT ELSILCQAET ALIISSQNGK  60
LYACGYPSPD AVIWRFLYGG DSSPPQRNDV RFLKKKQKEN VEVQRAQYES AHEALKEEKK  120
RLDKTKKERN SDNNGGCLGF SRWWENPIDD MDLEELVKFK ESLEQLKTNL IAATDNKINM  180
FQQMMMPSPV AAPSSLIMAP MQTSLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016185527.11e-139PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLK7KZN02e-61K7KZN0_SOYBN; Uncharacterized protein
STRINGGLYMA07G05001.15e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132271027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-19AGAMOUS-like 62