PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.S7YD6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 540aa    MW: 59830.4 Da    PI: 7.057
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.S7YD6genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.5e-32196253260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  +DgynWrKYGqK+vkgse+prsYY+Ct+++C +kkkvers  +++++ei+Y+g+Hnh+k
  Aradu.S7YD6 196 EDGYNWRKYGQKQVKGSENPRSYYKCTHPSCAMKKKVERSL-EGQITEIVYKGTHNHPK 253
                  7****************************************.***************85 PP

2WRKY101.74.4e-32367425159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg++++rsYY+Ct +gC+v+k+ver+a+d k v++tYeg+Hnh+
  Aradu.S7YD6 367 LDDGYRWRKYGQKVVKGNPNARSYYKCTAPGCSVRKHVERAATDIKSVITTYEGKHNHD 425
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.5E-28185254IPR003657WRKY domain
PROSITE profilePS5081122.894190254IPR003657WRKY domain
SuperFamilySSF1182901.06E-24191254IPR003657WRKY domain
SMARTSM007749.7E-35195253IPR003657WRKY domain
PfamPF031067.3E-25196252IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.8E-36352427IPR003657WRKY domain
SuperFamilySSF1182901.44E-27359427IPR003657WRKY domain
PROSITE profilePS5081136.793362427IPR003657WRKY domain
SMARTSM007741.1E-35367426IPR003657WRKY domain
PfamPF031063.7E-24368425IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MKTSSFTDLL SNNYSNINMN MDDFGDALIQ NQESVPKFKS VTPPSLPLEN SQTSSYFPFT  60
SSTFSPTEFL NSSLFLSSPN IFASPTIEAF AGHSFNNKED EKNFSEFSFQ TQTKTASPSQ  120
AEPLKTQDMW KFTEPINQAE FSSQREATKS EYPSTQSFSS EMVATKPELQ SNSVPESGSF  180
NYANTSQSIK EQRRSEDGYN WRKYGQKQVK GSENPRSYYK CTHPSCAMKK KVERSLEGQI  240
TEIVYKGTHN HPKPQSTRRS SSSQQIIHQQ PSSSCTNSGI SDQSVVTLGN PQLDRVSMQE  300
DSSASMGEEE FEQTSPTSYS GGDADELGPD AKRWKGENEH DGHSAYGSRT VREPRVVVQT  360
TSEIDILDDG YRWRKYGQKV VKGNPNARSY YKCTAPGCSV RKHVERAATD IKSVITTYEG  420
KHNHDVPAAR GSAGYNMNRN SLNRNNSNAP AAPIRPAAVN GYSSAPNFTN SLYNPRLPAT  480
GTQESSSLDM LQGSGLFGYT SLGRSMGSYG NNSQLSDGVY IKAKDERKDD SFLESFLSKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-39187428878Probable WRKY transcription factor 4
2lex_A2e-39187428878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015971606.10.0PREDICTED: probable WRKY transcription factor 33
TrEMBLA0A0B2RCF50.0A0A0B2RCF5_GLYSO; Putative WRKY transcription factor 33
STRINGGLYMA18G44030.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.17e-99WRKY DNA-binding protein 33