PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.RXK4E
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 315aa    MW: 35636 Da    PI: 7.2848
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.RXK4EgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.11.7e-221558144
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtle 44
                 kprl+WtpeLH+rF+eav+qLGG+ekAtPk+++++m+++gLtl 
  Aradu.RXK4E 15 KPRLKWTPELHQRFIEAVHQLGGAEKATPKSLMRVMGIQGLTLL 58
                 79****************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-191357IPR009057Homeodomain-like
SuperFamilySSF466891.79E-81457IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-141557IPR006447Myb domain, plants
PfamPF002496.5E-61755IPR001005SANT/Myb domain
PfamPF143792.7E-21101147IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQNQSVHFVL STDAKPRLKW TPELHQRFIE AVHQLGGAEK ATPKSLMRVM GIQGLTLLGK  60
SHQLETCSDN QQEDCRKIKS SHGHCSKENS VGEQKQVTEN MKIAQALHMQ MEVQRKLCEQ  120
IEVQKHLQLR IEAQGKYLQS VLKKAQEALQ GYNSSSIGLE LTKAELSQLV TVINNACPGS  180
PISELTETRG LSLRSDDERK QDKGTMCSLE SSLTSSESCG RKEEIHQPME EETRWNLKSF  240
NEISLEFPFE AFHQTGKGQS GDDSSKEERV RKRNAKTDSE GSYCVEQPSG KRCGNKLRKL  300
EFDLNNQYHN DTDSR
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.RXK4E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1373635e-48BT137363.1 Medicago truncatula clone JCVI-FLMt-17O6 unknown mRNA.
GenBankBT1494605e-48BT149460.1 Lotus japonicus clone JCVI-FLLj-19J4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015965699.10.0myb family transcription factor PHL8
SwissprotF4I2741e-55PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A445D5F10.0A0A445D5F1_ARAHY; Uncharacterized protein
STRINGGLYMA02G12070.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.15e-58G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]