PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.R83G6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 466aa    MW: 51671.4 Da    PI: 8.0225
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.R83G6genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.6e-33194250360
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  Aradu.R83G6 194 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGQIAEIVYKGEHNHPK 250
                  9***************************************.***************85 PP

2WRKY1031.7e-32384441259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   Dg++WrKYGqK+vkg+++prsYYrCt  +C+v+k+ver+ +dp+++++tYeg+Hnhe
  Aradu.R83G6 384 GDGFRWRKYGQKVVKGNPYPRSYYRCTNVKCNVRKHVERAIDDPRAFVTTYEGKHNHE 441
                  59*******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-29183251IPR003657WRKY domain
SuperFamilySSF1182909.94E-26191251IPR003657WRKY domain
SMARTSM007743.2E-37192250IPR003657WRKY domain
PROSITE profilePS5081124.122194251IPR003657WRKY domain
PfamPF031061.1E-25194249IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.7E-33369443IPR003657WRKY domain
PROSITE profilePS5081134.222378443IPR003657WRKY domain
SuperFamilySSF1182902.75E-28378443IPR003657WRKY domain
SMARTSM007748.3E-38383442IPR003657WRKY domain
PfamPF031061.6E-25385441IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MDIDEAERVV VAKPVASRPN CSTFRSFSEL LAGAINASSP QIESSQATVS AIRPKTVRFK  60
PALNRTPTAS VASQDDIFEA ALCDSSHKSP NSDTKQSLIY KPMAKLVSRT TVSLLANMGN  120
CRTIQQQSGQ SMEGGLHHIS HESFGTNLSS DLYHSHSITP PSETTEPCKM MQQNIEEDQK  180
ALTSAINCDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE RSFDGQIAEI  240
VYKGEHNHPK PQPPKRSGTA GMQGSGMVPD GVPQDVWSNN HSERNDSRIE NQNDTGLPAN  300
SVYGVKVSQP NDSILNACGI SPENSCGLSG ECEQGSKGFE AEEEESRSKR RRNESRSNEA  360
AVSEEALIEP RIVLQSSTDS EIIGDGFRWR KYGQKVVKGN PYPRSYYRCT NVKCNVRKHV  420
ERAIDDPRAF VTTYEGKHNH EMPIKNINPN VPSERDSQAS LSKDKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-31194443877Probable WRKY transcription factor 4
2lex_A1e-31194443877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015970013.10.0PREDICTED: WRKY transcription factor 44-like
RefseqXP_015970014.10.0PREDICTED: WRKY transcription factor 44-like
RefseqXP_015970015.10.0PREDICTED: WRKY transcription factor 44-like
TrEMBLI1NA430.0I1NA43_SOYBN; Uncharacterized protein
STRINGGLYMA19G36100.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.13e-95WRKY family protein