PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.R27T4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 307aa    MW: 33253.2 Da    PI: 7.2498
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.R27T4genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.5e-4371061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +r+da++sl+yeAear+rdPvyG+vg+i+ lq++l+q ++el  +k
  Aradu.R27T4   7 PCAACKFLRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNAAQRDDAVKSLAYEAEARLRDPVYGCVGLISVLQHRLRQIQVELTNAK 104
                  7*********************************************************************************************9999 PP

       DUF260  99 ee 100
                  +e
  Aradu.R27T4 105 KE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6346107IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQRFAYVH KVFGASNVAK LLNELNAAQR  60
DDAVKSLAYE AEARLRDPVY GCVGLISVLQ HRLRQIQVEL TNAKKELATY IGPQALQGVP  120
TTAILQHHHS FASQMFPYNG AMAASPAIAH GGQLMIRDAQ TAPPPPQQQI LEAQQLAAAV  180
VVRDQQDMFR GYDQHHQQQE FLRFNGGGFD MGSVSSGGGG YSQVSGGGSG GGSGDQLSPS  240
LALGSFDNPY HMQQGESHAH HLPLQAQLLL PPQQKQAQQQ AQSQHIPGHH HQQPSESEEC  300
RSVGPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-4841218124LOB family transfactor Ramosa2.1
5ly0_B6e-4841218124LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.R27T4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963954.10.0LOB domain-containing protein 36-like
RefseqXP_015963955.10.0LOB domain-containing protein 36-like
RefseqXP_020997789.10.0LOB domain-containing protein 36-like
RefseqXP_020997790.10.0LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-72LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A444WSX50.0A0A444WSX5_ARAHY; Uncharacterized protein
STRINGGLYMA11G06210.31e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-69ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]