PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.QU3D9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 296aa    MW: 33144.9 Da    PI: 8.3765
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.QU3D9genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.43.5e-343794260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
                 dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Aradu.QU3D9 37 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGTHNHPK 94
                 8****************************************.***************85 PP

2WRKY1084.5e-34212270159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  Aradu.QU3D9 212 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHD 270
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-292695IPR003657WRKY domain
SuperFamilySSF1182904.45E-263595IPR003657WRKY domain
SMARTSM007749.1E-373694IPR003657WRKY domain
PROSITE profilePS5081123.7783795IPR003657WRKY domain
PfamPF031063.8E-263793IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-38197272IPR003657WRKY domain
SuperFamilySSF1182904.18E-30204272IPR003657WRKY domain
PROSITE profilePS5081138.147207272IPR003657WRKY domain
SMARTSM007741.2E-39212271IPR003657WRKY domain
PfamPF031061.9E-26213270IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MKTENTCSNQ NNNGFQSDYS SNNNYQPQSQ TLSRRSDDGY NWRKYGQKQV KGSENPRSYY  60
KCTFPNCPTK KKVERSLDGQ ITEIVYKGTH NHPKPQNTRR NSSSSSNSAA FAIAPSNQMN  120
NSEVTDHQSY THGSGQMDSV ATPENSSISV GDDDFEQSSQ RCKSVGDEYD DDEPDAKRWK  180
IEGENEGISG GGSRTVREPR VVVQTTSDID ILDDGYRWRK YGQKVVKGNP NPRSYYKCTH  240
PGCPVRKHVE RASHDLRAVI TTYEGKHNHD VPAARGSGSH ASTNAQQPPQ QCKHCN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-3837273878Probable WRKY transcription factor 4
2lex_A1e-3837273878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015931935.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P51e-111WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A151U0U51e-169A0A151U0U5_CAJCA; Putative WRKY transcription factor 33
STRINGGLYMA14G38010.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-109WRKY DNA-binding protein 33