PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.QT9FH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 316aa    MW: 34238.3 Da    PI: 6.3078
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.QT9FHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.42.8e-3971061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++C++apyfp ++p++fa+vh++FGasn+ k+l++l++ +reda++sl++eAear++ PvyG+v++i  lqq+l+q + +l ++k
  Aradu.QT9FH   7 PCAACKFLRRKCTQECIFAPYFPPDNPQRFACVHRVFGASNIGKILNDLSPCQREDAVTSLAFEAEARLDSPVYGCVRHIVILQQRLHQIQMDLLHAK 104
                  7*******************************************************************************************999888 PP

       DUF260  99 ee 100
                  +e
  Aradu.QT9FH 105 SE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3126107IPR004883Lateral organ boundaries, LOB
PfamPF031957.7E-397103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSSTNSPCAA CKFLRRKCTQ ECIFAPYFPP DNPQRFACVH RVFGASNIGK ILNDLSPCQR  60
EDAVTSLAFE AEARLDSPVY GCVRHIVILQ QRLHQIQMDL LHAKSELSAY INPQGIQGPF  120
SPHGIRGLPL YPQGKPPSSS AALFGPPYGP NVIQSLMPPS SVQHNGPMNA NADLNPEQRE  180
LLEQQHDMMV RNYEQQQQEY LRYNAATGIE PVAAGSPVSV VTADGDGRGN GVFAQMAAHS  240
GGQGGELTPC LGLGTFDSGG TYHHQLQQEP PQHGGVGENY VGLANRHHYP VEAQFLLPSQ  300
QQPSESEDCK SVGPSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-43611010114LOB family transfactor Ramosa2.1
5ly0_B8e-43611010114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.QT9FH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015960280.20.0LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-55LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A445EXF90.0A0A445EXF9_ARAHY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2333723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-58ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]