PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.PM5NX
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 257aa    MW: 29162.8 Da    PI: 8.3765
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.PM5NXgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.81.9e-32180238159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  Aradu.PM5NX 180 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHT 238
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-33165238IPR003657WRKY domain
SuperFamilySSF1182901.19E-28172238IPR003657WRKY domain
PROSITE profilePS5081129.516175240IPR003657WRKY domain
SMARTSM007747.1E-37180239IPR003657WRKY domain
PfamPF031063.0E-25181237IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MMSTTTTSQT MVNNQSLFGE QDHHDNENMA TEMGFLPLLP TNMIFPTSPL GCNQQQPCYS  60
LLKPFSSILS PNSLASDQAD STSNLTAETL LATDAQQKSG LDLTSTTFLG PQFLSLNRST  120
ISNPWATGEV PDCFSSKRNV VDNHHHHVGV PTIKMKKIKG RRKVREPRFC FKTMSDVDVL  180
DDGYKWRKYG QKVVKNTQHP RSYYRCTQDN CRVKKRVERL AEDPRMVITT YEGRHAHTPS  240
NDVEDSQPPS QLTNFFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-27171237874Probable WRKY transcription factor 4
2lex_A9e-27171237874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015955933.10.0PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB73e-61WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A0B2RAY21e-111A0A0B2RAY2_GLYSO; Putative WRKY transcription factor 13
TrEMBLI1KTB91e-111I1KTB9_SOYBN; Uncharacterized protein
TrEMBLQ2PJS21e-111Q2PJS2_SOYBN; WRKY40
STRINGGLYMA08G15210.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.11e-60WRKY DNA-binding protein 13