PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.PJ3BC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 184aa    MW: 20278.5 Da    PI: 7.7472
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.PJ3BCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.8e-4424122199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el++++
  Aradu.PJ3BC  24 PCAACKFLRRKCLPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVIRLQKELDATN 121
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  Aradu.PJ3BC 122 A 122
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.79623124IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-4424121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MLFESKKIIY MASSSSSSSY SNSPCAACKF LRRKCLPDCI FAPYFPPEEP QKFANVHKIF  60
GASNVSKLLN EVQPHQREDA VNSLAYEAEA RIKDPVYGCV GAISVLQRQV IRLQKELDAT  120
NADLMRYCNE VPNPTLGRRN NHNNNNNNNN LGEGGGGSFY FPSSSSSAWN NDDTCGGGDG  180
YHRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-66141311119LOB family transfactor Ramosa2.1
5ly0_B3e-66141311119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.PJ3BC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015966303.11e-128LOB domain-containing protein 25
RefseqXP_015966304.11e-128LOB domain-containing protein 25
RefseqXP_020998611.11e-128LOB domain-containing protein 25
RefseqXP_020998612.11e-128LOB domain-containing protein 25
RefseqXP_025700677.11e-128LOB domain-containing protein 25
RefseqXP_025700678.11e-128LOB domain-containing protein 25
RefseqXP_025700679.11e-128LOB domain-containing protein 25
RefseqXP_025700680.11e-128LOB domain-containing protein 25
RefseqXP_025700681.11e-128LOB domain-containing protein 25
RefseqXP_029154257.11e-128LOB domain-containing protein 25
SwissprotQ8L8Q39e-69LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A445D3G71e-126A0A445D3G7_ARAHY; Uncharacterized protein
STRINGXP_007140818.17e-87(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-66LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]