PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.P4XEI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 352aa    MW: 39552.2 Da    PI: 8.5159
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.P4XEIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.1e-32146199255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Aradu.P4XEI 146 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 199
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15143200IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-28144200IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23146199IPR006447Myb domain, plants
PfamPF002492.3E-7147198IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MKATTPPPYT AMAMQMQSFS SSALLAEPDL SLNISPPFLS AKGTFKDMCS SISDSGSSGS  60
DASHDNNNNN NNCFFHHTHT VPQPTLTLGS GPASNLNHHH HYHHLHQYQM QGLSRNYFNH  120
HPHQPQIHCR SDFKRNGGGR RSMRAPRMRW TTTLHAHFVH AVQLLGGHER ATPKSVLELM  180
NVKDLTLAHV KSHLQMYRTV KSTDKVPGNN NNNNLGDALA VVCNGHKVDM GFEQQRQEVV  240
VDHLHAQRGL LQHPLVQLQQ SQRSSCQSRL LETNTNITRQ KPDISFVYSR LQDGNEIMNN  300
HGGLSNYLKM KERSDCNNLS SDSEGVIDLE FTLGRPTHHQ DESSRELTLL KC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-17147201357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-17147201357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-17147201357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-17147201357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-17147201458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.P4XEI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015934219.10.0probable transcription factor KAN4
RefseqXP_025612546.10.0probable transcription factor KAN4
TrEMBLA0A445BS150.0A0A445BS15_ARAHY; Uncharacterized protein
STRINGGLYMA17G36500.11e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-44G2-like family protein