PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.P3BGN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 420aa    MW: 46728 Da    PI: 7.2757
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.P3BGNgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.7e-33154211260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  dDgynWrKYGqK+vkgsefprsYY+Ct+ +C+vkkkver+  d++++ei+Y+g+Hnhek
  Aradu.P3BGN 154 DDGYNWRKYGQKQVKGSEFPRSYYKCTHLSCNVKKKVERAI-DGHITEIIYKGQHNHEK 211
                  8****************************************.***************85 PP

2WRKY105.82.2e-33316374159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k++er++ dpk+v++tYeg+Hnh+
  Aradu.P3BGN 316 LDDGYKWRKYGQKVVKGNPHPRSYYKCTSAGCNVRKHIERASMDPKAVITTYEGKHNHD 374
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-28145212IPR003657WRKY domain
SuperFamilySSF1182901.23E-25150212IPR003657WRKY domain
SMARTSM007748.5E-36153211IPR003657WRKY domain
PROSITE profilePS5081123.365154212IPR003657WRKY domain
PfamPF031064.9E-25154210IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-36301376IPR003657WRKY domain
SuperFamilySSF1182908.63E-29308376IPR003657WRKY domain
PROSITE profilePS5081138.423311376IPR003657WRKY domain
SMARTSM007743.3E-38316375IPR003657WRKY domain
PfamPF031069.6E-26317374IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MPTDSHSPAR PTITLPPRPS LESFLSSAGI SPGPMTLVSS FFADDYSPSP SSFSQLLAVT  60
PSPLFTVPPG FSPSAFLFSP THPQSPFGMS HQQALAQVTS EAVIAQSQGQ MQIDEDDASE  120
KNVEVSMFET SQMSNNADKK YQQPSSVVVN KPADDGYNWR KYGQKQVKGS EFPRSYYKCT  180
HLSCNVKKKV ERAIDGHITE IIYKGQHNHE KPHSNKRNKD NSDSNESVSI QPKSELSWVG  240
NSDSFGKSFS DCSISEDLGG VDMREEEGGD VEPNPKRRQA SFVCCRNIDV EVYEGHQTTV  300
TEPKIIVQTR SEVDLLDDGY KWRKYGQKVV KGNPHPRSYY KCTSAGCNVR KHIERASMDP  360
KAVITTYEGK HNHDVPASRK SSHNTSKPHK AVPEKHPDMD FGNSNQRPIH LSLKEEQIIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-39154377878Probable WRKY transcription factor 4
1wj2_A1e-39154377878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015946170.10.0PREDICTED: probable WRKY transcription factor 4 isoform X1
SwissprotQ9ZQ701e-117WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A0S3RRX90.0A0A0S3RRX9_PHAAN; Uncharacterized protein
STRINGGLYMA18G49830.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-115WRKY DNA-binding protein 3