PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.NTD67
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 512aa    MW: 55209.4 Da    PI: 8.5928
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.NTD67genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY795.3e-25199255259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +Dgy+WrKYGqK+vk+ + +rsYYrCt+++C +kk +e++++ ++v++++Y+++H h+
  Aradu.NTD67 199 SDGYSWRKYGQKQVKSPTGSRSYYRCTHSECAAKK-IECNDDAGRVIDVVYKSQHSHD 255
                  8******************************9988.*********************7 PP

2WRKY97.49.5e-31374430359
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+h+
  Aradu.NTD67 374 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVDNSNAVIITYKGVHDHD 430
                  9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.2E-20195257IPR003657WRKY domain
SuperFamilySSF1182901.16E-19196257IPR003657WRKY domain
SMARTSM007741.3E-23198256IPR003657WRKY domain
PROSITE profilePS5081118.406199257IPR003657WRKY domain
PfamPF031061.1E-18200255IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-31357432IPR003657WRKY domain
PROSITE profilePS5081131.904367432IPR003657WRKY domain
SuperFamilySSF1182903.66E-27368432IPR003657WRKY domain
SMARTSM007742.7E-35372431IPR003657WRKY domain
PfamPF031061.5E-23374429IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MAEQPSSAEA VTEGAPELLP KEKDSEGGEG GNEQGQQGKA SEGEERASES PCETDKPPKS  60
SDKPPKGSNS GTLAAESPVV NNRSDELQGS PATPNMDVKA ESKETDGPRE KETIASEAVQ  120
PPPTQIENQP QVSACSTPLS ELSPTSVTQS LSSVPSQIAP KQKMPPLKIN NVHVPQLDKK  180
IPSGGKHVSC GSVARVSVSD GYSWRKYGQK QVKSPTGSRS YYRCTHSECA AKKIECNDDA  240
GRVIDVVYKS QHSHDPPHKP NSTRESKLVS SSEPPNVENK VSQQLSIRGL KNSDPSPSKE  300
TLQDAPRTAD KKRPNSSNLS DNGKVILKEE HVNEPEPKKR MKKDDLADLD SPVKSGKKSR  360
FVVHAEGDVG ISGDGYRWRK YGQKMVKGNP HPRNYYRCTS AGCPVRKHIE TAVDNSNAVI  420
ITYKGVHDHD MPVPKKRHGP PSAPLVAAAA PASMNNSQSK KKPDSPKKQN KSTQWSVDTE  480
GELSGEAMDL GGEKAMESAR TLLSIGFEIK PC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A7e-27359432174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015932904.10.0PREDICTED: probable WRKY transcription factor 32 isoform X2
SwissprotP595831e-131WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV7CC730.0V7CC73_PHAVU; Uncharacterized protein
STRINGGLYMA02G36510.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-121WRKY DNA-binding protein 32