PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.NS2V2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 233aa    MW: 25542.7 Da    PI: 7.0041
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.NS2V2genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.4e-40521511100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+kll ++pe++r da++slvyeA++r++dPvyG++g i++lqqq++ l +el++++
  Aradu.NS2V2  52 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKLLMEVPENQRADAANSLVYEANVRLKDPVYGCMGAISSLQQQVQYLISELNAVR 149
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                  +e
  Aradu.NS2V2 150 DE 151
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.38851152IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4052149IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
SFCLIRSDRE RSDDEIGKKI KREGDGQKGR RQHMLGSQQE GASGGTINTI TPCAACKLLR  60
RRCAQECPFS PYFSPHEPQK FASVHKVFGA SNVSKLLMEV PENQRADAAN SLVYEANVRL  120
KDPVYGCMGA ISSLQQQVQY LISELNAVRD EIIKYKLREV NNAIIPSSSH HVMLPSSSSS  180
EVVSIAVPPP PPPPNDDILP PNSSTSSSMV YPQQTDDPSN YGTISSDNIS YFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-455116810125LOB family transfactor Ramosa2.1
5ly0_B3e-455116810125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.NS2V2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015973740.11e-166LOB domain-containing protein 15-like
SwissprotQ8L5T54e-75LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A444YDS01e-151A0A444YDS0_ARAHY; Uncharacterized protein
STRINGXP_007137607.17e-94(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-74LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]