PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.NEH05
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 300aa    MW: 32826.7 Da    PI: 9.5829
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.NEH05genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.11.9e-334296155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Aradu.NEH05 42 KPRLRWTQDLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 96
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5693999IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-323997IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-244297IPR006447Myb domain, plants
SuperFamilySSF466891.18E-164298IPR009057Homeodomain-like
PfamPF002491.9E-74495IPR001005SANT/Myb domain
PfamPF143793.6E-15138184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MYPRLIHPHE AGLVGQEDVQ VGGASNLTHK GDPCLVLTAD PKPRLRWTQD LHERFVDAVT  60
QLGGASKATP KAIMRTMNVK GLTLFHLKSH LQKYRLGKQS GKDMGEGCKD GLSGSYLESP  120
GTDNSSPKLP TSDTNEGFEI KEALRAQMEV QSKLHLQVEA EKHLQIRQDA EQRYMVMLER  180
ACKMLADQFI GATVIDTDNQ KFQGVGSKTP RGPMVDPLGF FSMPSTEVAG VNVSRHRGLT  240
VRLKTTGGLI LEGSPGEGKR RLLGMDSMAA PLIWTEAKMR TQAINVAQGN PHGITRYAGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.NEH05
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016197621.10.0protein PHR1-LIKE 2 isoform X1
RefseqXP_016197622.10.0protein PHR1-LIKE 2 isoform X1
RefseqXP_025646122.10.0protein PHR1-LIKE 2 isoform X1
RefseqXP_025646123.10.0protein PHR1-LIKE 2 isoform X1
TrEMBLA0A444ZDC90.0A0A444ZDC9_ARAHY; Uncharacterized protein
TrEMBLA0A445DJE30.0A0A445DJE3_ARAHY; Uncharacterized protein
STRINGXP_004486388.11e-179(Cicer arietinum)
STRINGGLYMA15G12930.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-63G2-like family protein