PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.N7C89
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Nin-like
Protein Properties Length: 325aa    MW: 37811.5 Da    PI: 4.9078
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.N7C89genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.63.7e-26141191252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +k +s +++s yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Aradu.N7C89 141 TKMLSRKMISDYFYMPITQAAKELDVGLTLLKKRCRELGIRRWPHRKLMSL 191
                  7889********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.37127211IPR003035RWP-RK domain
PfamPF020421.2E-20144191IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MASCNYFFNP QQIDEYPFPL PIQCSLYDYD YYYYSSENTN EYPPLGCWAH EFSIQDMECY  60
PSLPFYETLS IEPISTIKDY DFYDIKEGFS VWNEVDAGFD CSEKVSSSSS LSNNNNNEEN  120
KSIRRVINKR VCREERSSNS TKMLSRKMIS DYFYMPITQA AKELDVGLTL LKKRCRELGI  180
RRWPHRKLMS LQTLINNVQE LGKEEGRESE EKLRSAIEIL EKEKKLLEEM PDLQLEDNTK  240
RLRQACFKAN YKKRKLIMGS SSSNSSMESS SSYNIIGHNA TRITSSKGDT MDSVGFISFE  300
DEEDQERDIK YALSLPPLSH NIQMV
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.N7C89
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020989517.10.0protein RKD3-like
TrEMBLA0A445EJG70.0A0A445EJG7_ARAHY; Uncharacterized protein
STRINGGLYMA05G01030.26e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-41RWP-RK domain-containing protein