PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.MY047
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 331aa    MW: 37630.2 Da    PI: 4.5175
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.MY047genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.86.7e-145091344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i++   r+ tf kRr+g+lKK e L +LCd+++++ if++ +
  Aradu.MY047 50 IDDMNSRKATFKKRRAGLLKKLEQLAILCDIQACIAIFGPGD 91
                 888999*********************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.3714092IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-194099IPR002100Transcription factor, MADS-box
CDDcd002662.88E-2641123No hitNo description
SuperFamilySSF554556.02E-2042132IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-94262IPR002100Transcription factor, MADS-box
PfamPF003199.8E-155092IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-96277IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-97798IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MDNNGLNLFS APQERRVSFA ELARQYEMAA NNNNDDELPK MKRRVKLQLI DDMNSRKATF  60
KKRRAGLLKK LEQLAILCDI QACIAIFGPG DKSPTVWPSV EEAKEIVERF EEIPEPERSS  120
RMVTHQEYRQ QKVIWMEKQL EKLKKLNDQK EMAIFLHKIY NEHRPITDFS DDELDRFVTY  180
VDDKLKAVRN NIIRTRRSEV SISSQPPPAP PSAVAVQPLI ISGEVDSSVQ DELLFNAEQQ  240
QKNLEDVVVP NDEPDDDFFG GLFFEDKSNG SVLFPVGNEN VLVVPPAEAN EELFGFRDFA  300
DSVDFGDLDN FGDLTGNAAG TTSNDNHKGP W
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14163KRRVKLQLIDDMNSRKATFKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015964114.10.0PREDICTED: MADS-box transcription factor PHERES 2-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15602811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31640.18e-26AGAMOUS-like 92