PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.MVF8Z
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 278aa    MW: 30216.2 Da    PI: 8.1332
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.MVF8ZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.81.2e-40491481100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e +r da++slvyeA+ r+rdPvyG++g i+ lqqq+++l+ae+++++
  Aradu.MVF8Z  49 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLMEVGEGQRADAANSLVYEANLRLRDPVYGCMGAISGLQQQIQTLQAEVNAVR 146
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Aradu.MVF8Z 147 AE 148
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.14248149IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4049146IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
EVFVILEKER IDEIAKKVKK EGELLLSSSC SESEIERMGR KQSLNTVTPC AACKLLRRRC  60
AEECPFSPYF SPHEPQKFAA VHKVFGASNV SKMLMEVGEG QRADAANSLV YEANLRLRDP  120
VYGCMGAISG LQQQIQTLQA EVNAVRAEIL KYKYREAAAT ATATLISMNH HHHLPSNNNN  180
NQAPIIINNN NDNNAANSSS QQQGISQPPP LPPPPLRPAP PNPSLPSPST VVLSSSLSSS  240
SASSVYNNTP PKTTLSHGSI TSESVPYFAL IIWSNNLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-424916311125LOB family transfactor Ramosa2.1
5ly0_B2e-424916311125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.MVF8Z
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150364e-36AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015931864.10.0LOB domain-containing protein 15 isoform X1
RefseqXP_025609627.10.0LOB domain-containing protein 15 isoform X1
SwissprotQ9AT611e-69LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A445C7D40.0A0A445C7D4_ARAHY; Uncharacterized protein
STRINGGLYMA14G38280.23e-81(Glycine max)
STRINGXP_010256944.12e-81(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-70LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]