PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.M35ST
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family SBP
Protein Properties Length: 448aa    MW: 50744.7 Da    PI: 6.2818
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.M35STgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.5e-41172248177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqv gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrf  l efD++krsCrrrLa+hnerrrk+q
  Aradu.M35ST 172 VCQVYGCNMDLSSSKDYHKRHKVCDVHSKTAKVIVNGIEQRFCQQCSRFQLLAEFDDGKRSCRRRLAGHNERRRKPQ 248
                  6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.2E-33167234IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.086170247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.79E-39171252IPR004333Transcription factor, SBP-box
PfamPF031102.8E-31173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MEPWSYVPDE KGYLFSDEMD FSLDAFVRSR KAMTEWDNKA SCNFERGGFN SEREVVRSME  60
FVDLGFPDLF RKPFELDSNL SRRGNTSAQV IDLDSSLGEE ESESKHLSSL GELKAQDTSL  120
IDLKLGRIAD CQAASNDKVG NEGFTLIPMQ QPSPTTLAKR ARTSCSPNQT PVCQVYGCNM  180
DLSSSKDYHK RHKVCDVHSK TAKVIVNGIE QRFCQQCSRF QLLAEFDDGK RSCRRRLAGH  240
NERRRKPQFD YMTSKQHKIL HSHQGARYME SSLQKRPQFS FPDIFRSGKY DKISQNGNVK  300
LEEEFIFSPQ FAAPVAHGQE LSSRALSLLS AQSQIPSRPS EENPLASSFS FHSISEMPLD  360
ISNEGKYVVD ESFPCEMNHK EFIKSESAML SDAGHPDHRA SSDDICSPLE HGSTVDLFQL  420
SSNLERVEQK RNSVLVKWEN ENSCFPAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281722461084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.M35ST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF3122270.0KF312227.1 Arachis hypogaea squamosa promoter-binding-like protein (SPL6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015965744.10.0squamosa promoter-binding-like protein 6
RefseqXP_025700324.10.0squamosa promoter-binding-like protein 6
RefseqXP_029154219.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A445D5600.0A0A445D560_ARAHY; Uncharacterized protein
STRINGXP_007153485.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.19e-56SBP family protein