PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.LC3ZH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 170aa    MW: 18995.6 Da    PI: 9.1239
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.LC3ZHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY49.58.7e-161071452159
                  -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   +sYYrCt  +C+v+k+ver+ +dp+++++tYeg+Hnhe
  Aradu.LC3ZH 107 RKSYYRCTNVRCNVRKHVERAINDPRAFVTTYEGKHNHE 145
                  58************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182904.18E-1794147IPR003657WRKY domain
PROSITE profilePS5081119.9995147IPR003657WRKY domain
SMARTSM007745.2E-16100146IPR003657WRKY domain
PfamPF031061.6E-10107145IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.0E-15108147IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MLAAGKLIAN DVVAKEYLAS EIISHYVIHG VSVAEIVRNM ITVMGALIIA STLQIVLGFS  60
GLRRNVARRN ESRSNEAAVS EEALIEPRIV LQSSTDSEII GDGFHWRKSY YRCTNVRCNV  120
RKHVERAIND PRAFVTTYEG KHNHEIPTKN INPNIPSRRD SQASLSKDEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-1991147877Probable WRKY transcription factor 4
2lex_A2e-1991147877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015944824.19e-85PREDICTED: probable WRKY transcription factor 26
TrEMBLA7LHH04e-50A7LHH0_SOYBN; WRKY29 (Fragment)
TrEMBLA0A0R0KUJ31e-47A0A0R0KUJ3_SOYBN; Uncharacterized protein
TrEMBLA0A0B2PPE91e-47A0A0B2PPE9_GLYSO; WRKY transcription factor 44
TrEMBLK7KFQ71e-47K7KFQ7_SOYBN; Uncharacterized protein
STRINGGLYMA03G33376.14e-47(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.22e-25WRKY DNA-binding protein 26