PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.LB6JY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 424aa    MW: 46771.3 Da    PI: 8.5937
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.LB6JYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27130184156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  Aradu.LB6JY 130 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 184
                  5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.83127186IPR017930Myb domain
SuperFamilySSF466893.76E-18128187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-26129187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26130184IPR006447Myb domain, plants
PfamPF002491.3E-7133182IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MLGVSSPPVG STRRDERMES FKSIGVSSKD DGFGELSEGS LLESINFDDL FVGINMESDV  60
LPDLEMEADV FAQFFDNPKA AADQSSIHNK LASNKNEESV VVNPPTKNAG KGRKPSSQSK  120
SNNPQAKIRK VKVDWTPELH RRFVQAVEQL GVDKAVPSRI LEIMGIDCLT RHNIASHLQK  180
YRSHRKHLLA REAEAANWNQ RRQMYGGGIA GKRDMSSPWV APTMGFPPIT LMHHFRPLHV  240
WGHPSMDQSF IHTPTHSLSR PWVQPVALPF WHPHHQLSVD ANQNSKPCML YNNLEMCSSR  300
SLIVFCLFYT KAQNMLTPGS PCFPQPLTTR KYGSGGVAGS IPATSPHPHV MYKAADPPIN  360
GLSSPNPNPI IDFHPSKESI DAAIGDVLSK PWQPLPLGLK APALDSVLTE LQRQGISNIP  420
PSCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15129182457ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.LB6JY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015953694.10.0transcription activator GLK1 isoform X1
TrEMBLA0A445DZR20.0A0A445DZR2_ARAHY; Uncharacterized protein
STRINGXP_007149809.11e-142(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.18e-75GBF's pro-rich region-interacting factor 1