PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.KJ61Z
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family SBP
Protein Properties Length: 604aa    MW: 65778.2 Da    PI: 6.8551
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.KJ61ZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.41.7e-22166220256
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefD 56 
                  Cqv gC++dls +k+yh+rhkvCevhsk+++v+v+g+eqrfCqqC +  e++ f+
  Aradu.KJ61Z 166 CQVYGCNKDLSGCKDYHKRHKVCEVHSKTSKVIVNGIEQRFCQQCRQSFEIRSFN 220
                  *********************************************9998888885 PP

2SBP50.26.9e-162342644777
                  SSEEETTT--SS--S-STTTT-------S-- CS
          SBP  47 srfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  srfh l efD++krsCr+rLa+hnerrrk+q
  Aradu.KJ61Z 234 SRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 264
                  9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-29160250IPR004333Transcription factor, SBP-box
PROSITE profilePS5114126.863163263IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-21164220IPR004333Transcription factor, SBP-box
PfamPF031102.8E-17166220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-12234267IPR004333Transcription factor, SBP-box
PfamPF031101.7E-8234262IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MESWSYVSEE KGYVSNDAIS PPNTLGRNSK GSFLGWELKT PGGFSLENQG FEELGFPGMK  60
QLPQDPNPIG SVHSRKIDND PAMATPNAFS SRDDFNSKIS DSLGDSNGGG RDSLIDLKLG  120
RFPDHGDVGV AAPAFSKGAP ILSSSESSTP PKRVRASGIH SQTAYCQVYG CNKDLSGCKD  180
YHKRHKVCEV HSKTSKVIVN GIEQRFCQQC RQSFEIRSFN IMIYSAPVMF SLLSRFHLLA  240
EFDDGKRSCR KRLAGHNERR RKPQVGIHSG KPGRLLQPYG ESRFQGNMLT SASFICQEIL  300
PAGALSSERY GTSDWWRPIK TEGGAGFRHL SSVPISNGHP QSRPLFPSYN EKQFPFLHEN  360
NDATSAGGSI FCENNSSYPP AIGGPNSGSQ SLFQDTSIGG EDFNVFDTES AVQGLSGISD  420
SGCALSLLSS QSQNSSSQSS GIPMARSMVI RSSHSSSHYA MSQVSEKMIG ITSQASSGVS  480
DRFPSELNPA DGSPLSSVLI SDTNDIVNFE MADGIFHGSD FVNVKDRLSC DDVPTIDLLQ  540
LSSQLQRVES ERQSLQETVV IVQHVIKESK TQKDSNGSTS AYHNSTIYLD RIVLLSLKIY  600
ICNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-251662621184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.KJ61Z
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015945873.10.0squamosa promoter-binding-like protein 13A
RefseqXP_020989992.10.0squamosa promoter-binding-like protein 13A
TrEMBLA0A445B3R40.0A0A445B3R4_ARAHY; Uncharacterized protein
STRINGGLYMA04G32002.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-44SBP family protein