PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.K71EN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 96aa    MW: 11187.7 Da    PI: 8.7189
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.K71ENgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY44.33.5e-1438712659
                 EE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY 26 rCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 rCt  +C+v+k+ver+ +dp+++++tYeg+Hnhe
  Aradu.K71EN 38 RCTNVKCNVRKHVERAIDDPRAFVTTYEGKHNHE 71
                 9********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081117.2593873IPR003657WRKY domain
PfamPF031061.2E-93871IPR003657WRKY domain
SuperFamilySSF1182903.14E-113873IPR003657WRKY domain
SMARTSM007741.2E-63872IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-123873IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MEKKRVEVEQ ESLTSLSGRY KDFIKDFISI YELTFTTRCT NVKCNVRKHV ERAIDDPRAF  60
VTTYEGKHNH EMPIKNINPN VPSERDSQAS LSKDKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015970013.14e-35PREDICTED: WRKY transcription factor 44-like
RefseqXP_015970014.14e-35PREDICTED: WRKY transcription factor 44-like
RefseqXP_015970015.14e-35PREDICTED: WRKY transcription factor 44-like
RefseqXP_016207944.14e-35PREDICTED: WRKY transcription factor 44
RefseqXP_016207945.14e-35PREDICTED: WRKY transcription factor 44
RefseqXP_016207946.14e-35PREDICTED: WRKY transcription factor 44
TrEMBLA0A151TUZ82e-28A0A151TUZ8_CAJCA; WRKY transcription factor 44
TrEMBLA7LHH06e-29A7LHH0_SOYBN; WRKY29 (Fragment)
STRINGGLYMA03G33376.16e-27(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.22e-15WRKY family protein