PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.K0D8U
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family S1Fa-like
Protein Properties Length: 720aa    MW: 77696.6 Da    PI: 8.4122
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.K0D8UgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA22.52.3e-07313347741
         S1FA   7 eakGlnPGlivllvvgglllvflvgnyilyvyaqk 41 
                    kGl PGlivl+ v+    v l+g  i+yvy +k
  Aradu.K0D8U 313 SNKGLSPGLIVLISVADAAGVALIGLIIVYVYWKK 347
                  56******************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF082633.2E-102767IPR013210Leucine-rich repeat-containing N-terminal, plant-type
SuperFamilySSF520581.3E-4829287IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.106.2E-5829281IPR032675Leucine-rich repeat domain, L domain-like
PROSITE profilePS514504.986100122IPR001611Leucine-rich repeat
PROSITE profilePS514506.449124146IPR001611Leucine-rich repeat
PfamPF138552.9E-8124183IPR001611Leucine-rich repeat
PROSITE profilePS514507.003148170IPR001611Leucine-rich repeat
PROSITE profilePS514504.986221245IPR001611Leucine-rich repeat
PfamPF046891.7E-4313347IPR006779DNA binding protein S1FA
PROSITE profilePS5001132.485423718IPR000719Protein kinase domain
SMARTSM002202.3E-12427718IPR000719Protein kinase domain
PfamPF000691.7E-32428647IPR000719Protein kinase domain
SuperFamilySSF561125.26E-59428715IPR011009Protein kinase-like domain
Gene3DG3DSA:3.30.200.202.0E-14429485No hitNo description
CDDcd140663.41E-90429718No hitNo description
Gene3DG3DSA:1.10.510.101.6E-33486711No hitNo description
PROSITE patternPS001080546558IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
MSVNLFLCFF SFSFFFVFLI QTVFSLSPDG VALLTLKSAV DPAGAAALAN WNDGDATPCG  60
WSGVSCSNIS GDPDPRVVGV SLAGRGLRGY LPSELGTLLY LRRLNLHSNA FRGSIPSQLF  120
NATALRSLYL HSNNLSGDLP PSLFSLRRLQ NLDLSDNSLS GSIPNSLRNC SQLQRLVLAR  180
NRFSGKIPAT PWPELREIIQ LDLSANLLEG PIPDQIGELQ SLTGTLNLSF NHLSGNVPES  240
LGKLPVTVSF DLRNNNLSGE IPQTGSFSNQ GPTAFLNNPN LCGFPLQKPC SGSAQSEPGS  300
SPGSKRERSG SRSNKGLSPG LIVLISVADA AGVALIGLII VYVYWKKKDG CNGCSCTGKA  360
KFGGGENGKT RFLCCSLPCM NVGVLKSDDS ELEEGEKGER GRGEGELVAI DKGFNFELDE  420
LLRASAYVLG KSGLGIVYKV VLGNGVPVAV RRLGEGGEQR YKEFAAEVQA IGKVKHPNVV  480
KLRAYYWAPD EKLLISDFIS NGNLTTALRG RNGQPTMNLP WSTRLRIAKG AARGLAYLHE  540
CSPRKFVHGD IKPSNILLDG DFQPRISDFG LNRLISITGN NPSNGGFMGG ALPYFKPSQT  600
EHTNNYKAPE ARVPGSRPTQ KWDVYSFGVV LLELLTGKSP DSTPAPSTSM EVPDMVRWVR  660
KGFEQESPLS EMVDPPLLQE VHAKKEVLAV FHVALSCTEG DPEVRPRMKT VSENLEKIGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oac_A5e-4742871827297Protein BRASSINOSTEROID INSENSITIVE 1
4oab_A5e-4742871827297Protein BRASSINOSTEROID INSENSITIVE 1
4oa9_A5e-4742871827297Protein BRASSINOSTEROID INSENSITIVE 1
4oa6_A5e-4742871827297Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_B9e-4742871849319Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_A9e-4742871849319Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_B1e-4642871849319Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_A1e-4642871849319Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015961068.10.0PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830
TrEMBLI1KKK40.0I1KKK4_SOYBN; Non-specific serine/threonine protein kinase
STRINGGLYMA07G19200.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF540055
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12020.29e-11WRKY family protein