PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.IX9G9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 193aa    MW: 20809.3 Da    PI: 10.9957
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.IX9G9genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.27.6e-28111161152
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                  +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQk
  Aradu.IX9G9 111 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQK 161
                  59*******************.*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.24E-17108161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-26110161IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-22112161IPR006447Myb domain, plants
PfamPF002496.1E-7114161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRRTTSAGG THALIANPNH TRSCHRLRHP QSSHPNRRRH RHPNHPEPPP PPPPTTTATA  60
TTFXXXXXXX XXXXXPSPSH QQQPSSGGDF ADSGDLGSGA AGEEPARTLK RPRLVWTPQL  120
HKRFVDAVAH LGIKNAVPKT IMQLMSVDGL TRENVASHLQ KMGGGVAGYA EDMESANASG  180
ARKVLTLFPT GDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-28111161151Transcription factor LUX
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.IX9G9
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-47AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016181526.15e-48transcription factor MYBC1
RefseqXP_025681635.15e-48transcription factor MYBC1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.16e-37G2-like family protein