PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.IA8RP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7221.48 Da    PI: 10.6223
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.IA8RPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF104.34.2e-33959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Aradu.IA8RP  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                 79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002652.28E-38261No hitNo description
SuperFamilySSF554553.53E-31261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-34323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-20161161Myocyte-specific enhancer factor 2B
1tqe_R4e-20161161Myocyte-specific enhancer factor 2B
1tqe_Q4e-20161161Myocyte-specific enhancer factor 2B
1tqe_P4e-20161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6231631e-63AB623163.2 Pyrus pyrifolia var. culta PpMADS9-1 mRNA for MADS-box protein, complete cds.
GenBankU789471e-63U78947.1 Malus domestica MADS-box protein 1 mRNA, complete cds.
GenBankAJ0016811e-63AJ001681.1 Malus domestica mRNA for MADS box protein MdMADS8.
GenBankKP1640161e-63KP164016.1 Pyrus pyrifolia clone PpSEP1-2 SEP1-like MADS-box protein mRNA, complete cds.
GenBankKP1640021e-63KP164002.1 Pyrus pyrifolia clone PpSEP1-1 SEP1-like MADS-box protein mRNA, complete cds.
GenBankKC4152381e-63KC415238.1 Malus domestica cultivar Fuji Beni Shogun MADS8-1 mRNA, complete cds.
GenBankKC4152371e-63KC415237.1 Malus domestica cultivar Fuji Beni Shogun MADS8-2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016438828.12e-38PREDICTED: MADS-box protein CMB1-like
RefseqXP_009622386.13e-38PREDICTED: MADS-box protein CMB1-like
RefseqXP_007158666.13e-38hypothetical protein PHAVU_002G1723001g, partial
RefseqXP_007158665.13e-38hypothetical protein PHAVU_002G1723001g, partial
RefseqXP_010532441.17e-38PREDICTED: developmental protein SEPALLATA 3-like isoform X1
RefseqXP_010532442.17e-38PREDICTED: developmental protein SEPALLATA 3-like isoform X2
RefseqXP_008801853.18e-38PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform X4
RefseqXP_010913018.19e-38PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform X2
SwissprotQ034893e-39AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLD6MK583e-38D6MK58_9ASPA; Transcription factor (Fragment)
STRINGVIT_01s0010g03900.t014e-37(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.11e-39MIKC_MADS family protein