PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.I8GKQ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 365aa    MW: 40064.9 Da    PI: 7.295
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.I8GKQgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.7e-32190247259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+ver+ +dp++v++tYeg+Hnh+
  Aradu.I8GKQ 190 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCSVKKRVERCYRDPTTVITTYEGQHNHP 247
                  8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-34174249IPR003657WRKY domain
SuperFamilySSF1182905.49E-29181249IPR003657WRKY domain
PROSITE profilePS5081132.512184249IPR003657WRKY domain
SMARTSM007747.2E-37189248IPR003657WRKY domain
PfamPF031065.7E-25190247IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSDEAKQLLY QDLILDHHQN QNIIAGGGRL SNNMFCEKQF PSSSSSSSQV AFDPSSYMSF  60
TECLQGGMDY NSLATSFGLS PSSSEVFSSI EGNNNNQKPE GDVLGTGGGG GGGSETLATL  120
NSSISSSSSE AGGEEDSGKS NKDSQVKEEA AGETSKKGNK ENNNNKKKGE KKQKEPRFAF  180
MTKSEVDHLE DGYRWRKYGQ KAVKNSPYPR SYYRCTTQKC SVKKRVERCY RDPTTVITTY  240
EGQHNHPVPT SLRGNAASMF TPSMLSISAP TPLLSSAGHH DLALFAPLSH HHNQYSAASG  300
SQSSLLFHHH QSINNNVNNN NINNNNNNSL LLLNHHHHPY NNQQLPPEYG LLQDMLPSMF  360
LKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-271822491077Probable WRKY transcription factor 4
2lex_A3e-271822491077Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015957478.10.0PREDICTED: probable WRKY transcription factor 28
TrEMBLA0A0B2QWC31e-104A0A0B2QWC3_GLYSO; Putative WRKY transcription factor 28
TrEMBLI1K3041e-104I1K304_SOYBN; Uncharacterized protein
STRINGGLYMA05G25770.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.13e-50WRKY DNA-binding protein 28