PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.I4ZZ8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family M-type_MADS
Protein Properties Length: 225aa    MW: 26638.6 Da    PI: 9.6558
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.I4ZZ8genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.82.2e-161152344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i n+  r vt+ kR+ g++KK +ELS+LC+++++ i++ s++
  Aradu.I4ZZ8 11 ITNDAARRVTYKKRKRGMMKKISELSTLCGVDACAIVYNSRQ 52
                 89************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.068161IPR002100Transcription factor, MADS-box
CDDcd002661.14E-17290No hitNo description
PRINTSPR004049.5E-11323IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-22398IPR002100Transcription factor, MADS-box
PfamPF003194.0E-171152IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MARSKVKLAY ITNDAARRVT YKKRKRGMMK KISELSTLCG VDACAIVYNS RQDAHPLDEP  60
EVWPSRMGVE RVIEKFRQLP EIDQNRKRMD HADYLTLRIA KEKEKLKKKR HDNNEKEFQL  120
RMHDFMLRNR LPENLSFFDL NNLAYHTDMK LREVDMRLQM LLEKENKEMM MDFAPSSQPI  180
HGPYHPLESG ESSGKNMNHF SFMEENNHNN YNSGFDMILG NARIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100109KEKEKLKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015931798.11e-169PREDICTED: agamous-like MADS-box protein AGL80
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2961122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-36AGAMOUS-like 80