PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.I2J7R
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 173aa    MW: 18831.4 Da    PI: 8.483
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.I2J7RgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.14.9e-46171161100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvh++FGasnv k+l++lp ++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+la ++
  Aradu.I2J7R  17 PCAACKLLRRRCAQDCVFAPYFPADEPHKFANVHRVFGASNVNKMLQDLPMHQRRDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQAQLAIAQ 114
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                  +e
  Aradu.I2J7R 115 AE 116
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.76616117IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4517114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MKEQGGGGGR KQGAASPCAA CKLLRRRCAQ DCVFAPYFPA DEPHKFANVH RVFGASNVNK  60
MLQDLPMHQR RDAVSSMVYE ANARVRDPVY GCVGAISSLQ QQIDVLQAQL AIAQAEVVHL  120
KMRQPNYISN GMGPNSPTNS GSPPSKVMDS QAKPIFGMDM VVDQASYDDS MWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-49131187112LOB family transfactor Ramosa2.1
5ly0_B1e-49131187112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.I2J7R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015959233.11e-127LOB domain-containing protein 4
RefseqXP_025694254.11e-127LOB domain-containing protein 4
SwissprotQ9SHE94e-72LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A445DIX41e-126A0A445DIX4_ARAHY; Uncharacterized protein
STRINGXP_004505337.14e-97(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.19e-73LOB domain-containing protein 4