PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.HZI51
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 209aa    MW: 23216 Da    PI: 4.6549
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.HZI51genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.4e-42361351100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++C+lapyfp ++p kf ++h++FGasn++k+l+++pe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  Aradu.HZI51  36 PCAACKILRRRCTEKCMLAPYFPPTEPTKFTIAHRVFGASNIVKFLQEIPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVNELRAQLAKTQ 133
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Aradu.HZI51 134 AE 135
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.01135136IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4236133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MEGSDTNNTT YSNSTSTSSG DPPPPAAATV AVVMSPCAAC KILRRRCTEK CMLAPYFPPT  60
EPTKFTIAHR VFGASNIVKF LQEIPESQRA DAVSSMVYEA SARIRDPVYG CAGAICQLQK  120
QVNELRAQLA KTQAEVATMQ FQQANLVALI YMEMAQQQSS QQQQQEFESS PQQSSMEDFN  180
VPSPHYQQSN INYFEDNPSL NSLWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-41261361111LOB family transfactor Ramosa2.1
5ly0_B6e-41261361111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.HZI51
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-