PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.HR3NA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 408aa    MW: 45505.5 Da    PI: 5.051
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.HR3NAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.51.7e-34206260155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+rWtpeLHe+Fveav+qLGGsekAtPk +l+lmkvkgLt++hvkSHLQkYR+
  Aradu.HR3NA 206 KPRMRWTPELHEAFVEAVNQLGGSEKATPKGVLNLMKVKGLTIYHVKSHLQKYRT 260
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.516203263IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-32204262IPR009057Homeodomain-like
SuperFamilySSF466894.48E-18204260IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-25206260IPR006447Myb domain, plants
PfamPF002497.5E-10208259IPR001005SANT/Myb domain
PfamPF143794.1E-20293337IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSSCSPVLPT PLDNKYMKPP DSFQLSPIRE MTVNPSPLQS TSSNSNTRST GHTFSSPDVV  60
SFSSASQHER QHQPSSFVSQ TLGEDSVSSE LHSATFISQP QESDEISWGP DPFQGMLGFP  120
ENVSVQHDQV ENGACYTNDD NVKQSDFGEW VDKLMSIDDS YDPNWSQLLG DDNESEPKPK  180
PIQQQNVPSK EVKGLPSSPS TASQTKPRMR WTPELHEAFV EAVNQLGGSE KATPKGVLNL  240
MKVKGLTIYH VKSHLQKYRT ARYKPETPEG TSEKKLSSIE EMKSLDLKTS KGITEALRLQ  300
MELQKRLHEQ LEIQRKLQIQ IENQGKRLQM MFEQQREMGD SKFKDSSSSS LDEPSNSEAP  360
KEENEKLGSE SCITKAGPGE SSRDESTKQE MADEAQISVP PPTKRVKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-30206264260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.HR3NA
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015968464.10.0protein PHR1-LIKE 1
RefseqXP_020981874.10.0protein PHR1-LIKE 1
RefseqXP_020981875.10.0protein PHR1-LIKE 1
SwissprotQ8GUN51e-92PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A444YKL40.0A0A444YKL4_ARAHY; Uncharacterized protein
STRINGGLYMA03G41040.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-87G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]