PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.HD2AV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 1158aa    MW: 131793 Da    PI: 7.2176
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.HD2AVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY68.51e-2110821137358
                   -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY    3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58  
                   Dgy+WrKY qK++ g+ + r YYrC  +gCp+kk+v+r ++dp++  itY+g+H++
  Aradu.HD2AV 1082 DGYTWRKYDQKDILGTVHRREYYRCNGRGCPAKKRVQRIRDDPSLYRITYQGHHTC 1137
                   9*****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF009318.5E-8225451IPR002182NB-ARC
Gene3DG3DSA:3.80.10.105.7E-26489681IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520581.09E-29507714IPR032675Leucine-rich repeat domain, L domain-like
PfamPF138551.1E-9542599IPR001611Leucine-rich repeat
SMARTSM0036921565588IPR003591Leucine-rich repeat, typical subtype
SMARTSM003697.2612634IPR003591Leucine-rich repeat, typical subtype
Gene3DG3DSA:3.80.10.105.7E-26788956IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520581.09E-29790957IPR032675Leucine-rich repeat domain, L domain-like
PROSITE profilePS5081119.95610751135IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.7E-2310791138IPR003657WRKY domain
SuperFamilySSF1182903.92E-2110791138IPR003657WRKY domain
SMARTSM007745.1E-2610801139IPR003657WRKY domain
PfamPF031066.6E-2110821137IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043531Molecular FunctionADP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1158 aa     Download sequence    Send to blast
MKSEAGEFPK MEMKPFNILK TDMNELLKNK TADFFDKTKS EGASASQTST LTSLKSTNSS  60
LVSKNSLRRK RDLMSLLCSY PLDARMISDD FKSKPYDERQ LPLKLKGLLP KEIIRDAENG  120
DRSWSWSGSS FGDAHLDFIP EAILNLAADL SVHQLIQTLI SICKSENPNH TKCIRLSTRS  180
DVEKRTVEAK VTAALNDKHN MLDILNSFRR PLTIDASGYP TSEAENELKQ HICQLLQLST  240
IEDDDILCTR QIEDEMSRSR YLVILVDRDG EEIVDPQKVG LCSTLQSGVL VLITTDSPAS  300
QQAKEGGLTD ELVDLEIRTN DHLLPWVVFC HSVGKKFVYS SSAILTTAAH IVEECRSHLH  360
AILLVAKLLK NHQDVRKWDL ALFKLRCFNP SHDFHNFHGS NSIMIKAFLS LIWDGMKKIQ  420
QNCLLSCLVI PKIQEGMVDH ELMNHWMSYL FLDAGKTEKN LSQLVENSIF LQLNGVGGRY  480
IWLTEETYQI LERLHTSYPL FIEKSNLGLT EPSNTDKWHN AVRIELAGNK ISELPQSPDC  540
LRLKVLMLQN NADLTKIPSL FFDHMPLLCI LNLSYTSVRE LPRSLFFLEQ LRELYLKGCE  600
CFMKLPPEIG NLKKLEKLDL DETQITHLPK EVQKLTNMQS LTLCFYEYRV KKNRSYSCST  660
IIPSGVLSKL KRLEHLCIGV NPDDERWNEN VQAILPEILG LECLKTLSMY IPQLELLKLI  720
PAHIFKLDFR FTVGRHMQRI ISSIPPATDV EFKQSGCSLK FVKGEGVPDE IKMLLRNSKA  780
LFLDRHFTLQ SLSECEMKNI EQLRVCILAE CKEMQTIGGG GAAKDDEDML PHLLFLSLFH  840
MKNLRSIWEG PTPPRSSFGM LQSLSLQSCP KLITLFSVDF LGNFSLLKEL IVKDCPKLST  900
LVSCHSFRHI AHTFLPKLNK LLLLHLPELT SLSSGLHIGP VLKKIAFYDC PKLHSLSTRE  960
LISQELTVIK GESNWWRELE GRPCKFDQIF SPIHEEADIM SQLGTYEYDG DNMDSGSDWL  1020
HSHVKTGGSV AAPLHPIVDA NSLASSGKDF QKGSRVSKHR LLDRNCSLPT WDIETSDFME  1080
YDGYTWRKYD QKDILGTVHR REYYRCNGRG CPAKKRVQRI RDDPSLYRIT YQGHHTCGGQ  1140
AQLELSPTLI GELHRFSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015943642.10.0PREDICTED: uncharacterized protein LOC107468799 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1447945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22570.15e-19WRKY DNA-binding protein 38