PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.H5WTM
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 628aa    MW: 68621.8 Da    PI: 6.1065
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.H5WTMgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.11.1e-24138187151
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQ
  Aradu.H5WTM 138 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVDKLTRENVASHLQ 187
                  79*******************.***************************** PP

2Response_reg49.32.7e-172092175
                  EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEE CS
  Response_reg  1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekdpDlillDiempgmdGlellkeireeepklpii 75
                  vl vdD+p+ +++l+++l++ +y +v++++++ +al+ll+e+++Dl++ D+ mp+mdG++ll+     e++lp+i
   Aradu.H5WTM 20 VLAVDDDPTCLMVLETLLRRCQY-HVTTTSQAIKALKLLRENKFDLVISDVHMPDMDGFKLLELVGL-EMDLPVI 92
                  799********************.*************************************987633.3356665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521726.4E-221692IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.0E-241692No hitNo description
SMARTSM004486.0E-1118177IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011023.90119126IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.8E-142092IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.12E-152192No hitNo description
Gene3DG3DSA:1.10.10.602.9E-25135188IPR009057Homeodomain-like
PROSITE profilePS512949.823135194IPR017930Myb domain
SuperFamilySSF466898.42E-16136188IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-22138188IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MTMENGVDDS SDQFPKGMRV LAVDDDPTCL MVLETLLRRC QYHVTTTSQA IKALKLLREN  60
KFDLVISDVH MPDMDGFKLL ELVGLEMDLP VITQEHLAAS GNSEQNGKLN KKRKDQDDEE  120
DEEQDNGHDN EDPSAQKKPR VVWSVELHRK FVAAVNQLGI DKAVPKKILD LMNVDKLTRE  180
NVASHLQAIS VALYYYFFLK YRLYLKRISC VANQQANMVA ALGSADPSYL RMGSLSGVGH  240
LQALSGSGQF PNNAFRSFPP NGMVSRLNTP AGLNVHGFPS SGAFHLGQSQ NLNSSTVEQL  300
KYRSSIVPVN QNGVHGMQVP MGLDPLQHNK GVIPVQNLTT GIDAKTNFPV SNKLPDPQSR  360
VASGAHPPLL GSSNNALMLE ARPQDTQGVL EYENLSSSVP SQHSELPFSL LDQGRYSDNW  420
SSAVQSSGIQ TGSYPSSGSF RQTAIPATDN MASLPLQEGN LSVSSSISLL PNQSYNSLID  480
THSQAVILAN RTGHVSNSDV PFQGWDDRNE DASYHSNAVC NTINTVAPGS SSVGHTTINS  540
TLHRNLEFNY GDSLQMKRDA MTKLAKGTSL KPHQVNIMNQ QKSQQGNFSN NVGSLEDLVS  600
SMMKQEQDEM KILDGGFICD NYSGGISM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-24134193160ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.H5WTM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0196011e-50CU019601.8 M.truncatula DNA sequence from clone MTH2-12A22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020989808.10.0LOW QUALITY PROTEIN: two-component response regulator ARR12
TrEMBLA0A444X5V50.0A0A444X5V5_ARAHY; Uncharacterized protein
STRINGGLYMA06G06730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.16e-87response regulator 12