PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.G9G5G
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GeBP
Protein Properties Length: 116aa    MW: 12784.5 Da    PI: 10.0362
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.G9G5GgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57333.31.4e-105584397
       DUF573 43 ksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                 + i +++s   l eKir+LKkKf+++ +k k+gk  +  k+h+ ++++l k +Wg
  Aradu.G9G5G  5 NLIRANASCMKLKEKIRQLKKKFENNLEKEKNGKG-TTLKPHELEALQLGKNVWG 58
                 5688999999*******************888887.6779**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-9758IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MKGSNLIRAN ASCMKLKEKI RQLKKKFENN LEKEKNGKGT TLKPHELEAL QLGKNVWGHD  60
GCGGETVLNE TAKKDTVNNE KAAKITSKKA LVPHSNEKAE AKSKLNSEPL DSNEDS
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.G9G5G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015945400.15e-76uncharacterized protein LOC107470510
RefseqXP_029145238.16e-75probable transcription factor At1g61730
TrEMBLA0A445B4W79e-74A0A445B4W7_ARAHY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490