PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.G83RZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 572aa    MW: 64212.6 Da    PI: 5.9847
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.G83RZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like47.24.8e-15168204137
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmk 37 
                  k+r+rWtpeLHe+Fveav+qLGGse+A  k++++ ++
  Aradu.G83RZ 168 KQRMRWTPELHEAFVEAVNQLGGSERAPEKKLMDSIE 204
                  79****************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-12166203IPR009057Homeodomain-like
SuperFamilySSF466891.56E-5166202IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-8168201IPR006447Myb domain, plants
PfamPF143792.4E-20217259IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF042786.6E-10333386IPR007378Tic22-like
Gene3DG3DSA:3.40.850.107.3E-7452518IPR001752Kinesin motor domain
PfamPF002252.4E-5454518IPR001752Kinesin motor domain
SuperFamilySSF525404.62E-5456524IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007018Biological Processmicrotubule-based movement
GO:0003677Molecular FunctionDNA binding
GO:0003777Molecular Functionmicrotubule motor activity
GO:0005524Molecular FunctionATP binding
GO:0008017Molecular Functionmicrotubule binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MSSSFPVLPT SAAQASSINS NIRSVGHMFS TPADFPDDGV PFPTASEIHA TTQASQPLRQ  60
IDDVSWGADL FDNILLFPDN NNAPFQNDHT VYSAPFSSSD NPKAVDFEWV DPFMSDDDPL  120
QLNWNQFVSD TNVAEPKPKE SQLSIQQQVP SVEANGLPDS VSTTPQTKQR MRWTPELHEA  180
FVEAVNQLGG SERAPEKKLM DSIEEMNPLD LKTSKGITEA LRLQMELQKR LHEQLEIQRK  240
LQIQIEDQGK RLQMMFEKQI EGSSSAPISS TGQHTNENSE PQNDDNDKQE QGDEQLVAPP  300
PKRLCSSRLW PRRRIKFLHD LPVYFLFLHD LLMYALSNPS EEFLLVVGAS TGKNLGLFCF  360
NEDDVHALLC QVSTIDPRLC DGSKVVLHST RMPKHLRSPL LMKPASRIHS RAVVAFFLRC  420
IGNVESLVKL LVDCILEAKE NIDGNFAASL HNENMDKTDD KLKIRSCNDD ELSLPYATLC  480
LVTSTADVLT LMKLSEVNRA VNSVALNNRN SRSHRLFNSV YSPCMFTEKI HRIHGSGSNR  540
ISLLEGKPVP YKKERDARTP PLTAARTSKR WL
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.G83RZ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN2015279e-54JN201527.1 Glycine max PHR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020986742.10.0LOW QUALITY PROTEIN: protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A445BJP80.0A0A445BJP8_ARAHY; Uncharacterized protein
STRINGXP_004495581.18e-99(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.22e-40G2-like family protein