PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.G4UPX
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 323aa    MW: 36185.9 Da    PI: 7.1663
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.G4UPXgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.8e-19103153656
                  S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++  eq+++Le+ Fe  ++++ e++ +LAk lgL+ rq+ +WFqNrRa++k
  Aradu.G4UPX 103 RLGMEQVKALEKSFEAGNKLDPERKMQLAKALGLQPRQIAIWFQNRRARWK 153
                  56789*********************************************9 PP

2HD-ZIP_I/II130.66.3e-4299191193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekk+rl  eqvk+LE+sFe+ +kL+perK++la++Lglqprq+a+WFqnrRAR+ktkqlEk+ye+Lk+++da+k++n++L++++++L++el++
  Aradu.G4UPX  99 EKKKRLGMEQVKALEKSFEAGNKLDPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEVLKKQFDAVKADNDSLKTQNQKLHAELEA 191
                  69***************************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-1992157IPR009057Homeodomain-like
PROSITE profilePS5007116.95795155IPR001356Homeobox domain
SMARTSM003892.5E-1998159IPR001356Homeobox domain
CDDcd000863.64E-17100156No hitNo description
PfamPF000462.7E-16102153IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-20104162IPR009057Homeodomain-like
PRINTSPR000311.2E-5126135IPR000047Helix-turn-helix motif
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5135151IPR000047Helix-turn-helix motif
PfamPF021833.7E-15155194IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAFPPSHSFI FHHDHQQPQH HPLRTTPPSA PDFPSFPPHH LHFPAGGGGG GGGGSWMKRS  60
MSFSGIDTTK NCGGGAGPDE LALLHGDDEL SDDGSQIGEK KKRLGMEQVK ALEKSFEAGN  120
KLDPERKMQL AKALGLQPRQ IAIWFQNRRA RWKTKQLEKE YEVLKKQFDA VKADNDSLKT  180
QNQKLHAELE ALKGSREWCE NGTMITLKKE NEGSWSNNGS DNSSDMNLDL SRTPVMNSPV  240
SSSHNNNNNN NNNNNNNNNN NNKSLVLPNN SLKPASITQL LQCSSSSRSD LQDEGFCNMF  300
HNIDEQHQNF WPWPTTENHH HFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147155RRARWKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.G4UPX
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015946190.10.0homeobox-leucine zipper protein HAT7 isoform X1
TrEMBLA0A445B3A50.0A0A445B3A5_ARAHY; Uncharacterized protein
STRINGXP_007151217.11e-122(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-56HD-ZIP family protein