PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.FG20F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 429aa    MW: 47607.1 Da    PI: 5.8601
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.FG20FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.21.1e-9124262373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykalppsetsekn...sseelaalkl..fsevsPilkf 93 
                  ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla  f++AL ar a+++s ++ +a++  ++s+++   +++++++ +l  f++++P+++f
  Aradu.FG20F   2 EQLLVHCANAIETNDVTLAQQILWVLNNIAPPDGDSNQRLAGSFLRALTARAANTGScKMLAAVADAAASRNSlaiETHRFSVIELanFVDLTPWHRF 99 
                  79***************************************************94331444445444444455566566666666699********** PP

         GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg........skeeleetgerLakfAeelgvpfefnvl.. 181
                  ++ +aN aIlea+eg + +Hi+D+++++++Q p+L++a+a R e pp +++T+ g++  +           ++ee+g +L +fA++ +v +ef+v+  
  Aradu.FG20F 100 GFTAANAAILEATEGFSVIHIVDLSLTHCMQIPTLIDAIAGRHEVPPVIKLTVPGAAFREgninipplLDLSYEELGAKLVNFARSKNVVMEFSVVss 197
                  ****************************************************999976667899998888999**********************977 PP

         GRAS 182 .....vakrledleleeLrvkp..........gEalaVnlvlqlhrll.............................desvsleserdevLklvksls 235
                        a+ +e l+++     +          +Eal++n++++lh+++                             + s s++s r+ +Lk+v+sl+
  Aradu.FG20F 198 syadgFASLIEHLRVQ-----HivsvaeghrpNEALVINCHMMLHYIPdetalvhhhhetdsnlnpfivhdysssssSPSSSSSSLRSMFLKAVRSLE 290
                  7444444444555555.....44444457777*****************************************998644444455889********** PP

         GRAS 236 PkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                  P+++++v++++d+ s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+egaer+er e ++kW++r+++a F+ + +se+ 
  Aradu.FG20F 291 PTIMILVDEDVDLISNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGAERVERVEPKSKWEQRMRNASFHGIGFSEES 387
                  *****************************************************.******************************************** PP

         GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   +++k +l +++  g+ v++e++ l+l+Wk+++++++SaW
  Aradu.FG20F 388 ISEVKGMLDEHA-AGWGVKKEDDNLLLTWKGHNVIFASAW 426
                  ************.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.081408IPR005202Transcription factor GRAS
PfamPF035143.7E-892426IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MEQLLVHCAN AIETNDVTLA QQILWVLNNI APPDGDSNQR LAGSFLRALT ARAANTGSCK  60
MLAAVADAAA SRNSLAIETH RFSVIELANF VDLTPWHRFG FTAANAAILE ATEGFSVIHI  120
VDLSLTHCMQ IPTLIDAIAG RHEVPPVIKL TVPGAAFREG NINIPPLLDL SYEELGAKLV  180
NFARSKNVVM EFSVVSSSYA DGFASLIEHL RVQHIVSVAE GHRPNEALVI NCHMMLHYIP  240
DETALVHHHH ETDSNLNPFI VHDYSSSSSS PSSSSSSLRS MFLKAVRSLE PTIMILVDED  300
VDLISNNLVC RLRSAFNYLW IPYDTVDTFL PRGSKQRQWY EADICWKIEN VIAHEGAERV  360
ERVEPKSKWE QRMRNASFHG IGFSEESISE VKGMLDEHAA GWGVKKEDDN LLLTWKGHNV  420
IFASAWLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-51242888474Protein SHORT-ROOT
5b3h_B4e-52242834420Protein SHORT-ROOT
5b3h_E4e-52242834420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.FG20F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963847.10.0scarecrow-like protein 32
SwissprotQ9SN221e-167SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A444WU210.0A0A444WU21_ARAHY; Uncharacterized protein
STRINGGLYMA05G22140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-168GRAS family protein