PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.F4C71
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 211aa    MW: 24271.2 Da    PI: 7.3415
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.F4C71genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-2090145156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +rk+ ++tkeq ++Lee F+++++p+ ++++eLA++l+L  rqV vWFqNrRa+ k
  Aradu.F4C71  90 KRKKLRLTKEQSTILEESFKNHSNPNPKQKQELATHLHLLPRQVEVWFQNRRARTK 145
                  79999*************************************************98 PP

2HD-ZIP_I/II117.95.6e-3891179189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+keq+++LEesF+++++ +p++K+ela++L+l prqv+vWFqnrRARtk+kq+E+d+e+Lk++y++l+een+rL++e +eL++
  Aradu.F4C71  91 RKKLRLTKEQSTILEESFKNHSNPNPKQKQELATHLHLLPRQVEVWFQNRRARTKLKQTESDCEFLKKCYESLTEENKRLQNELQELKS 179
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-1976141IPR009057Homeodomain-like
SuperFamilySSF466894.15E-1979148IPR009057Homeodomain-like
PROSITE profilePS5007118.25387147IPR001356Homeobox domain
SMARTSM003892.6E-1789151IPR001356Homeobox domain
CDDcd000861.84E-1590148No hitNo description
PfamPF000465.4E-1890145IPR001356Homeobox domain
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PfamPF021832.4E-10147180IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.4E-19147190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MKRKEDDPSR KCNNKAYPSL TLGPAIIDDD DNHNQGSKII EDSNNSSPSA VSSFSNSSII  60
IKKEKDQEFE VEIDEKAPSS SRDEDGNNTK RKKLRLTKEQ STILEESFKN HSNPNPKQKQ  120
ELATHLHLLP RQVEVWFQNR RARTKLKQTE SDCEFLKKCY ESLTEENKRL QNELQELKSM  180
QTTTPFSMQI PPTTLTICPS CETISYCCPK F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.F4C71
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015972544.21e-148homeobox-leucine zipper protein HAT9-like
SwissprotQ6YPD07e-56HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLA0A444YVY01e-145A0A444YVY0_ARAHY; Uncharacterized protein
STRINGGorai.002G137300.12e-63(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-57homeobox from Arabidopsis thaliana