PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ES4A3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 189aa    MW: 21231.4 Da    PI: 7.6728
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ES4A3genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-323893156
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                 k+r++W+peLH+rF++a++qLGG+++AtPk+i+elm+v++Lt+++vkSHLQkYRl+
  Aradu.ES4A3 38 KQRRCWSPELHRRFINALQQLGGAQVATPKQIRELMQVESLTNDEVKSHLQKYRLH 93
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1773595IPR017930Myb domain
SuperFamilySSF466891.2E-183696IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-293696IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-273893IPR006447Myb domain, plants
PfamPF002498.7E-84091IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MTTTPAPELK SSSSKSNSSS LFMNRVEIQA QQSQNPRKQR RCWSPELHRR FINALQQLGG  60
AQVATPKQIR ELMQVESLTN DEVKSHLQKY RLHVRKFPVS SSAEHDANNN NIDDDDEDDL  120
WEMKKKDQCG KGNKNSSSQS QSGSPQGPLL LAGSVKGLSS MDADDEHSDC RNWKAAIHHQ  180
PPESDNHSR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.ES4A3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963952.11e-136transcription factor HHO5 isoform X1
RefseqXP_015963953.11e-136transcription factor HHO5 isoform X2
SwissprotQ9FX849e-34HHO6_ARATH; Transcription factor HHO6
TrEMBLA0A444WSZ71e-135A0A444WSZ7_ARAHY; Uncharacterized protein
TrEMBLA0A444WT141e-135A0A444WT14_ARAHY; Uncharacterized protein
STRINGGLYMA01G39040.15e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.12e-33G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]