PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ER3NJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 431aa    MW: 47495.1 Da    PI: 8.0431
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ER3NJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.31.4e-32278333156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv+a+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Aradu.ER3NJ 278 KQRRCWSPELHRRFVNALQKLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 333
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.89E-18275336IPR009057Homeodomain-like
PROSITE profilePS5129414.461275335IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-29276336IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-27278333IPR006447Myb domain, plants
PfamPF002494.4E-8280331IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MGSVPAELSL DIRAPTPPPP PPPSTPSFIP KTITDFLSAL STTGITASEK QSRINEELEK  60
CSEGERKSEP VLEVFIPLKR EFDHSEDDEE HNNNNNNNDN NNNNNNIRQE KECRDKMSWM  120
SSVQLWNASS STTLNNNNNN NAFDNNHKHH HQNHHHKFGT KKNQEYVVEN PFQSHSNVRN  180
NGGRGFMPFT SYTSCSVPVT TVALSATKEE KEDIGAINRL PLLTPAAAGG GVKTLREGSG  240
SSGSRTSSNN RPVSTSSPPA AAHRTAMMPL QPQQTARKQR RCWSPELHRR FVNALQKLGG  300
SQVATPKQIR ELMQVDGLTN DEVKSHLQKY RLHTRRVPSG SGNHSHNHNQ SVVVLGGLWM  360
SQGQDQCNDS SKGSSSGSGS PQSPLHLATR SRGGTSPAEA DDSMEDDEDA KSESYSWKSH  420
THHKQVKVVD V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-13278331154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13278331154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13278331154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13278331154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.ER3NJ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015944942.10.0transcription factor HRS1
TrEMBLA0A445B7930.0A0A445B793_ARAHY; Uncharacterized protein
STRINGGLYMA02G15320.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-36G2-like family protein