PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.EGP2W
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 370aa    MW: 42332.9 Da    PI: 6.8783
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.EGP2WgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-3197150255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Aradu.EGP2W  97 PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 150
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-3093151IPR009057Homeodomain-like
PROSITE profilePS5129412.21893153IPR017930Myb domain
SuperFamilySSF466897.53E-1595151IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2297152IPR006447Myb domain, plants
PfamPF002492.7E-998149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MSKEYADEII IEEDEETSSL GCCSQKCSSF DLNEEASSEE EEEEGGKNKK EEDEAACDEE  60
EINANGTSNS REDEGNNNNK NNERRGGVRQ YVRSKMPRLR WTPELHLSFV HAVERLGGQE  120
RATPKLVLQL MNVRGLSIAH VKSHLQMYRS KKLDETGQVL GQTYRSRQLH EVVGRSRNHH  180
ELLNPHHHFK MGNGGIILAT NFNHHHHFQG SLMPHHHHPH FSLSSRLRVT SNEIVSSSSN  240
HQGRSSSNQV QVMDTSCRIA PIRPSHFLEE KKWPPLEIMN NHHQWKFKGP TTIGNIPESV  300
QPSIREYLST SKNNLRLEFD PPFRIKLNEV KREKREERLP NLQLGLSHGG DGSDDDCRET  360
QEISTKLSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1798152357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.EGP2W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015942990.10.0putative Myb family transcription factor At1g14600
TrEMBLA0A445BBY00.0A0A445BBY0_ARAHY; Uncharacterized protein
STRINGGLYMA05G29161.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-36G2-like family protein