PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.E8B97
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 281aa    MW: 32003.9 Da    PI: 8.807
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.E8B97genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.8e-332781155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt++LH+rFv+av++LGG++kAtPk++l++m++kgLtl+h+kSHLQkYRl
  Aradu.E8B97 27 KPRLRWTTDLHDRFVDAVTKLGGPDKATPKSVLRIMGLKGLTLYHLKSHLQKYRL 81
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-322482IPR009057Homeodomain-like
PROSITE profilePS5129412.2552484IPR017930Myb domain
SuperFamilySSF466893.94E-162684IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-242782IPR006447Myb domain, plants
PfamPF002492.1E-82980IPR001005SANT/Myb domain
PfamPF143792.9E-23125171IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGSSYGGGIG GGEGGYGVVM SMTREPKPRL RWTTDLHDRF VDAVTKLGGP DKATPKSVLR  60
IMGLKGLTLY HLKSHLQKYR LGQQAKKQNE EHHKENNRYS YVNFSNSSSE FSTSFRGDNE  120
RGEIPIAEAL RHQIEVQKRL EEQLEVQKKL QMRIEAQGKY LQAVLEKAQR TLSMEGSGNN  180
LEASRAQLTE FNSALSNFME NMNNKDSKQS ILDMNDFYSK VHGSCFHNYH EVIRREENID  240
QKPKIEEGSI QFDLNIKDNY DFVSARGAGS EIEAKMLSYR L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-192783258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.E8B97
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020997585.10.0myb family transcription factor PHL11
SwissprotC0SVS45e-81PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A444WVI61e-175A0A444WVI6_ARAHY; Uncharacterized protein
STRINGXP_007158199.11e-147(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-75G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]