PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.E2930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 173aa    MW: 19999.2 Da    PI: 9.4555
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.E2930genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.61.1e-3299156158
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh
  Aradu.E2930  99 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH 156
                  59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-3484156IPR003657WRKY domain
SuperFamilySSF1182905.75E-2991156IPR003657WRKY domain
PROSITE profilePS5081129.60894156IPR003657WRKY domain
SMARTSM007741.3E-3799158IPR003657WRKY domain
PfamPF031061.7E-25100156IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MQGGERSGVP NYELQVPFTN ITTPSTTTAT TKNWHNKQVG TLDPKAVNDE NCTGNSSEGN  60
NNITWWKSSA ATEKNKVKMR RKLREPRFCF QTRSDVDVLD DGYKWRKYGQ KVVKNSLHPR  120
SYYRCTHSNC RVKKRVERLS EDCRMVITTY EGRHNHIPSD DSNSSDHECF TSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-2790156874Probable WRKY transcription factor 4
2lex_A6e-2790156874Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015962089.11e-129PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY41e-72WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A151QW857e-91A0A151QW85_CAJCA; Putative WRKY transcription factor 12
STRINGGLYMA07G13611.16e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72943245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.19e-73WRKY family protein