PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.D6WHF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 191aa    MW: 21338 Da    PI: 9.2483
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.D6WHFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.62.9e-293491259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 +Dgy+WrKYG+K+ k+s+fprsYYrCt  gC++kk+ver  +dp+ v +tY g H h+
  Aradu.D6WHF 34 EDGYKWRKYGKKSLKKSPFPRSYYRCTAIGCNAKKRVERYMDDPTHVLTTYVGLHAHD 91
                 8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-282193IPR003657WRKY domain
PROSITE profilePS5081128.2082893IPR003657WRKY domain
SuperFamilySSF1182901.06E-262893IPR003657WRKY domain
SMARTSM007744.6E-303392IPR003657WRKY domain
PfamPF031062.3E-223490IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MASVADTMKM NNKRNKNNLS KITYLTESES ENLEDGYKWR KYGKKSLKKS PFPRSYYRCT  60
AIGCNAKKRV ERYMDDPTHV LTTYVGLHAH DLPPILPPPS RSFNLYNNST VSPKLGKGSD  120
EQKPILSDAS AGARERMYAN NTITSVNVRT DSDSCVNDVG SIENIGTGLL EDIVNLSSIA  180
PHYQHHQPTS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-2426931077Probable WRKY transcription factor 4
2lex_A8e-2426931077Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015948913.11e-141PREDICTED: probable WRKY transcription factor 68
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2364423
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-31WRKY DNA-binding protein 23