PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.D1DYZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRF
Protein Properties Length: 456aa    MW: 49031.3 Da    PI: 7.7244
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.D1DYZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC69.83.3e-2298139142
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
                  daep rCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk+
  Aradu.D1DYZ  98 DAEPNRCRRTDGKKWRCSREVAPNHKYCERHMHRGRTRSRKP 139
                  79**************************************96 PP

2QLQ52.71.3e-183566233
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33
                 +FT aQ+ +L++Q+++yKy++a+ PvPpeLl+
  Aradu.D1DYZ 35 PFTSAQWRELERQAMIYKYMMASIPVPPELLL 66
                 8*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.7E-103471IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.9183570IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-133566IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.19798142IPR014977WRC domain
PfamPF088797.7E-1999139IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MGEFGVSLKE TKKNSVAAAT RTSGGMMAAS LGRFPFTSAQ WRELERQAMI YKYMMASIPV  60
PPELLLMPIA AASRSSPLEG GGGGGGFNLR LSSSNNNDAE PNRCRRTDGK KWRCSREVAP  120
NHKYCERHMH RGRTRSRKPR ARHDSHPYAA SSAAVTVAFS NHSTRKDPSS PHFLASATTN  180
HHSYLESASS LSLHNFGAGS VPSSREPRGL DWMLNGDPIS LGTSDSEWNT LMNNNKVGFN  240
AMSSCSNTEP QYMNSFPVYS PGLDQQHNKR SPTFLNPVLV PMETLQSDKP RVFIDAWSDA  300
ATDQETNDAD NKNSVSSIEK LSLSSLDLSM GGGYMHEEVG LGLMEEPEPE ENNTSNGNKS  360
GFSNWPTPPP WVASTTTPGG PLAEVLMPST VTSTNDGAAA TSNSNLSSPA TTMVSSPSGV  420
LHKTLASLSD SSSNSSPRVP SSGANSEIAL LRFNQK
Cis-element ? help Back to Top
SourceLink
PlantRegMapAradu.D1DYZ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015944680.10.0growth-regulating factor 1
TrEMBLA0A445B6F50.0A0A445B6F5_ARAHY; Uncharacterized protein
STRINGGLYMA04G40880.21e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-34growth-regulating factor 7