PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.CW4J0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 504aa    MW: 55005.3 Da    PI: 7.4817
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.CW4J0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.17.5e-28124180259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +DgynWrKYGqK+vkg+ef rsYY+Ct+++C++kk++e+s+ d+++++ +  g+Hnh+
  Aradu.CW4J0 124 KDGYNWRKYGQKNVKGNEFIRSYYKCTHPNCQAKKQLEQSN-DGQITDSICIGQHNHP 180
                  7***************************************9.***************8 PP

2WRKY104.84.4e-33300358159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ++Dgy+WrKYGqK vkg+ +prsYYrC+s+gCpvkk+ver+++d kvv++tYeg+H+he
  Aradu.CW4J0 300 VNDGYRWRKYGQKLVKGNANPRSYYRCSSPGCPVKKHVERASHDSKVVITTYEGQHDHE 358
                  58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081120.3118182IPR003657WRKY domain
SuperFamilySSF1182905.62E-23119182IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-24119182IPR003657WRKY domain
SMARTSM007741.9E-30123181IPR003657WRKY domain
PfamPF031062.5E-22124180IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-34287360IPR003657WRKY domain
SuperFamilySSF1182901.57E-28292360IPR003657WRKY domain
PROSITE profilePS5081134.589295360IPR003657WRKY domain
SMARTSM007749.1E-38300359IPR003657WRKY domain
PfamPF031069.1E-26301357IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MEAVTVVPMV SSEETADHNV PYAIPLQRAS PHSDITESQG IHGAETPSSK QKEETSIPSA  60
VAQNKVKDSD VTASALQSDR QRSTHIAASV EKLVQSPDTP FREKRHPSQS GHDSPSIIRE  120
RVSKDGYNWR KYGQKNVKGN EFIRSYYKCT HPNCQAKKQL EQSNDGQITD SICIGQHNHP  180
RPQSSITKPV GPVLPVLEEG PDKPRVANVE VEDKSLNEHA SVPQQMKFSH SLQITNVPAA  240
DLMKAAHSQL TTANDEVHNN DYPDSKRQKT DDSNIEVSVA DKSTCASRVV VQTSSEVDFV  300
NDGYRWRKYG QKLVKGNANP RSYYRCSSPG CPVKKHVERA SHDSKVVITT YEGQHDHEIP  360
PGRTVTHNAA TNAQTTTING KPGTNSVSNP VSTDTRGSRS NEKVNGNSIT KSEAGKSPES  420
KLNGQQQQKN ENAVAKQDSV GANITCQSNS EDPCRSKSNE QPKDDVETKS EGKNGSPNLV  480
VHDTPGQEGQ LKKQSASDAE AVQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-38122362176WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150363e-78AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015972903.10.0PREDICTED: WRKY transcription factor 1-like isoform X1
SwissprotQ9SI377e-85WRKY1_ARATH; WRKY transcription factor 1
TrEMBLV7B9E50.0V7B9E5_PHAVU; Uncharacterized protein
STRINGGLYMA02G47650.11e-177(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93583343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.23e-84zinc-dependent activator protein-1